Leiomodin 1 antibody

Catalog No. ABIN632381

Product Details anti-Leiomodin 1 Antibody

Target: Leiomodin 1 (LMOD1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Leiomodin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Leiomodin 1 Blocking Peptide, catalog no. 33R-8783, is also available for use as a blocking control in assays to test for specificity of this Leiomodin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Leiomodin 1

Target: Leiomodin 1 (LMOD1)

Alternative Name: Leiomodin 1 (LMOD1 Products)

Synonyms: 1D antibody, 64kD antibody, D1 antibody, SM-LMOD antibody, 9530015K06Rik antibody, SM-Lmod antibody, leiomodin 1 antibody, leiomodin 1 (smooth muscle) antibody, LMOD1 antibody, Lmod1 antibody

Background: The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

Molecular Weight: 67 kDa (MW of target protein)