FBXO33 antibody (Middle Region)
-
- Target See all FBXO33 Antibodies
- FBXO33 (F-Box Protein 33 (FBXO33))
-
Binding Specificity
- Middle Region
-
Reactivity
- Rat, Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO33 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO33 antibody was raised against the middle region of FBXO33
- Purification
- Affinity purified
- Immunogen
- FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
- Top Product
- Discover our top product FBXO33 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO33 Blocking Peptide, catalog no. 33R-9590, is also available for use as a blocking control in assays to test for specificity of this FBXO33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO33 (F-Box Protein 33 (FBXO33))
- Alternative Name
- FBXO33 (FBXO33 Products)
- Synonyms
- FBXO33 antibody, BMND12 antibody, Fbx33 antibody, c14_5247 antibody, 5730501N20Rik antibody, AI642135 antibody, F-box protein 33 antibody, F-box protein 33 S homeolog antibody, FBXO33 antibody, fbxo33 antibody, fbxo33.S antibody, Fbxo33 antibody
- Background
- FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognises and binds to phosphorylated target proteins. recognises YBX1.
- Molecular Weight
- 62 kDa (MW of target protein)
-