SENP5 antibody (Middle Region)
-
- Target See all SENP5 Antibodies
- SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SENP5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SENP5 antibody was raised against the middle region of SENP5
- Purification
- Affinity purified
- Immunogen
- SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR
- Top Product
- Discover our top product SENP5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SENP5 Blocking Peptide, catalog no. 33R-5426, is also available for use as a blocking control in assays to test for specificity of this SENP5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))
- Alternative Name
- SENP5 (SENP5 Products)
- Background
- The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.
- Molecular Weight
- 87 kDa (MW of target protein)
-