-
- Target
- KLK-BL4
- Binding Specificity
- C-Term
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- KLK-BL4 antibody was raised against the C terminal Of Klkbl4
- Purification
- Affinity purified
- Immunogen
- KLK-BL4 antibody was raised using the C terminal Of Klkbl4 corresponding to a region with amino acids EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLK-BL4 Blocking Peptide, catalog no. 33R-2284, is also available for use as a blocking control in assays to test for specificity of this KLK-BL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLKBL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLK-BL4
- Background
- Klkbl4 is a secreted protein. Klkbl4 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.
- Molecular Weight
- 44 kDa (MW of target protein)
-
You are here:
