KCTD21 antibody (N-Term)

Catalog No. ABIN632359

Product Details anti-KCTD21 Antibody

Target: KCTD21 (Potassium Channel Tetramerisation Domain Containing 21 (KCTD21))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD21 antibody was raised against the N terminal of KCTD21

Purification: Affinity purified

Immunogen: KCTD21 antibody was raised using the N terminal of KCTD21 corresponding to a region with amino acids RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD21 Blocking Peptide, catalog no. 33R-7845, is also available for use as a blocking control in assays to test for specificity of this KCTD21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD21

Target: KCTD21 (Potassium Channel Tetramerisation Domain Containing 21 (KCTD21))

Alternative Name: KCTD21 (KCTD21 Products)

Synonyms: EG622320 antibody, KCASH2 antibody, RGD1559529 antibody, potassium channel tetramerization domain containing 21 antibody, potassium channel tetramerisation domain containing 21 antibody, KCTD21 antibody, Kctd21 antibody

Background: KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Molecular Weight: 30 kDa (MW of target protein)