DENND2C antibody (Middle Region)

Catalog No. ABIN632358

Product Details anti-DENND2C Antibody

Target: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DENND2C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DENND2 C antibody was raised against the middle region of DENND2

Purification: Affinity purified

Immunogen: DENND2 C antibody was raised using the middle region of DENND2 corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DENND2C Blocking Peptide, catalog no. 33R-1994, is also available for use as a blocking control in assays to test for specificity of this DENND2C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DENND2C

Target: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Alternative Name: DENND2C (DENND2C Products)

Synonyms: si:dkeyp-46c9.6 antibody, MGC145874 antibody, dJ1156J9.1 antibody, A930010I20Rik antibody, RGD1308197 antibody, DENN domain containing 2C antibody, DENN/MADD domain containing 2C antibody, DENND2C antibody, dennd2c antibody, Dennd2c antibody

Background: The specific function of DENND2C is not yet known.

Molecular Weight: 100 kDa (MW of target protein)