FBXO16 antibody (N-Term)
-
- Target See all FBXO16 Antibodies
- FBXO16 (F-Box Protein 16 (FBXO16))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO16 antibody was raised against the N terminal of FBXO16
- Purification
- Affinity purified
- Immunogen
- FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA
- Top Product
- Discover our top product FBXO16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO16 Blocking Peptide, catalog no. 33R-1795, is also available for use as a blocking control in assays to test for specificity of this FBXO16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO16 (F-Box Protein 16 (FBXO16))
- Alternative Name
- FBXO16 (FBXO16 Products)
- Synonyms
- si:ch211-89p3.1 antibody, zgc:112464 antibody, FBX16 antibody, 4932435C24Rik antibody, Fbx16 antibody, F-box protein 16 antibody, FBXO16 antibody, LOC100150082 antibody, fbxo16 antibody, Fbxo16 antibody
- Background
- FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO16 belongs to the Fbx class.
- Molecular Weight
- 34 kDa (MW of target protein)
-