FBXL14 antibody (N-Term)

Catalog No. ABIN632352

Product Details anti-FBXL14 Antibody

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXL14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXL14 antibody was raised against the N terminal of FBXL14

Purification: Affinity purified

Immunogen: FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXL14 Blocking Peptide, catalog no. 33R-9997, is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXL14

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Alternative Name: FBXL14 (FBXL14 Products)

Synonyms: AW322056 antibody, Fbx14l antibody, Fbl14 antibody, Ppa antibody, fbl13 antibody, fbxl14 antibody, ppab antibody, wu:fc44g06 antibody, CG9952 antibody, Dmel\CG9952 antibody, FBXL14 antibody, I-55 antibody, T21F11.10 antibody, T21F11_10 antibody, PPA antibody, fi25d04 antibody, ppaa antibody, wu:fb34d05 antibody, wu:fi25d04 antibody, F-box and leucine-rich repeat protein 14 antibody, F-box and leucine rich repeat protein 14 antibody, F-box and leucine-rich repeat protein 14 S homeolog antibody, F-box and leucine-rich repeat protein 14b antibody, Partner of paired antibody, RNI-like superfamily protein antibody, F-box and leucine-rich repeat protein 14a antibody, Fbxl14 antibody, FBXL14 antibody, fbxl14.S antibody, fbxl14b antibody, Ppa antibody, AT1G80570 antibody, fbxl14a antibody

Background: FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Molecular Weight: 46 kDa (MW of target protein)