MED8 antibody (N-Term)

Catalog No. ABIN632351

Product Details anti-MED8 Antibody

Target: MED8 (Mediator Complex Subunit 8 (MED8))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MED8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MED8 antibody was raised against the N terminal of MED8

Purification: Affinity purified

Immunogen: MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MED8 Blocking Peptide, catalog no. 33R-6339, is also available for use as a blocking control in assays to test for specificity of this MED8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MED8

Target: MED8 (Mediator Complex Subunit 8 (MED8))

Alternative Name: MED8 (MED8 Products)

Synonyms: ARC32 antibody, 2210021A15Rik antibody, AB041805 antibody, MNCb-2386 antibody, zgc:76877 antibody, med8-a antibody, mediator complex subunit 8 antibody, mediator complex subunit 8 L homeolog antibody, component of RNA polymerase II antibody, mediator complex subunit Med8 antibody, MED8 antibody, Med8 antibody, med8 antibody, med8.L antibody

Background: MED8 is a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. MED8 also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha