MED8 antibody (N-Term)
-
- Target See all MED8 Antibodies
- MED8 (Mediator Complex Subunit 8 (MED8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MED8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MED8 antibody was raised against the N terminal of MED8
- Purification
- Affinity purified
- Immunogen
- MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA
- Top Product
- Discover our top product MED8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MED8 Blocking Peptide, catalog no. 33R-6339, is also available for use as a blocking control in assays to test for specificity of this MED8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MED8 (Mediator Complex Subunit 8 (MED8))
- Alternative Name
- MED8 (MED8 Products)
- Background
- MED8 is a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. MED8 also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-