EXOC6 antibody (N-Term)

Catalog No. ABIN632342

Product Details anti-EXOC6 Antibody

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOC6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EXOC6 antibody was raised against the N terminal of EXOC6

Purification: Affinity purified

Immunogen: EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOC6 Blocking Peptide, catalog no. 33R-6184, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOC6

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Alternative Name: EXOC6 (EXOC6 Products)

Synonyms: Sec15 antibody, Sec15l1 antibody, EXOC6A antibody, SEC15 antibody, SEC15L antibody, SEC15L1 antibody, SEC15L3 antibody, Sec15p antibody, 4833405E05Rik antibody, AW413330 antibody, C430002C19 antibody, hbd antibody, msec15 antibody, zgc:77548 antibody, SEC15A antibody, EXOC6 antibody, 3R41 antibody, CG7034 antibody, Dmel\\CG7034 antibody, dsec15 antibody, exocyst complex component 6 antibody, exocyst complex component 6B antibody, Exocyst complex component 6 antibody, Secretory 15 antibody, Exoc6 antibody, EXOC6 antibody, exoc6 antibody, LOC410084 antibody, EXOC6B antibody, CpipJ_CPIJ005438 antibody, Tsp_03288 antibody, sec-15 antibody, Sec15 antibody

Background: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis