USP36 antibody (N-Term)
-
- Target See all USP36 Antibodies
- USP36 (Ubiquitin Specific Peptidase 36 (USP36))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This USP36 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- USP36 antibody was raised against the N terminal of USP36
- Purification
- Affinity purified
- Immunogen
- USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
- Top Product
- Discover our top product USP36 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
USP36 Blocking Peptide, catalog no. 33R-8754, is also available for use as a blocking control in assays to test for specificity of this USP36 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP36 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- USP36 (Ubiquitin Specific Peptidase 36 (USP36))
- Alternative Name
- USP36 (USP36 Products)
- Background
- Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes such as the one encoded by USP36.
- Molecular Weight
- 123 kDa (MW of target protein)
-