USP36 antibody (N-Term)

Catalog No. ABIN632340

Product Details anti-USP36 Antibody

Target: USP36 (Ubiquitin Specific Peptidase 36 (USP36))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP36 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: USP36 antibody was raised against the N terminal of USP36

Purification: Affinity purified

Immunogen: USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP36 Blocking Peptide, catalog no. 33R-8754, is also available for use as a blocking control in assays to test for specificity of this USP36 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP36

Target: USP36 (Ubiquitin Specific Peptidase 36 (USP36))

Alternative Name: USP36 (USP36 Products)

Synonyms: wu:fd19b04 antibody, MGC81933 antibody, 2331 antibody, CG5505 antibody, Dmel\\CG5505 antibody, USP36 antibody, Usp36 antibody, anon-WO0118547.247 antibody, dUSP36 antibody, et antibody, l(3)02331 antibody, mule antibody, DUB1 antibody, 2700002L06Rik antibody, mKIAA1453 antibody, ubiquitin specific peptidase 36 antibody, ubiquitin specific peptidase 36 S homeolog antibody, scrawny antibody, usp36 antibody, usp36.S antibody, USP36 antibody, scny antibody, Usp36 antibody

Background: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes such as the one encoded by USP36.

Molecular Weight: 123 kDa (MW of target protein)