SYDE1 antibody

Catalog No. ABIN632336

Product Details anti-SYDE1 Antibody

Target: SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYDE1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SYDE1 Blocking Peptide, catalog no. 33R-7447, is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYDE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYDE1

Target: SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))

Alternative Name: SYDE1 (SYDE1 Products)

Synonyms: 7h3 antibody, 1200008N06Rik antibody, BB043000 antibody, RGD1305857 antibody, synapse defective Rho GTPase homolog 1 antibody, synapse defective 1, Rho GTPase, homolog 1 (C. elegans) antibody, SYDE1 antibody, Syde1 antibody

Background: SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molecular Weight: 80 kDa (MW of target protein)