CCDC78 antibody (Middle Region)

Catalog No. ABIN632324

Product Details anti-CCDC78 Antibody

Target: CCDC78 (Coiled-Coil Domain Containing 78 (CCDC78))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC78 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC78 antibody was raised against the middle region of CCDC78

Purification: Affinity purified

Immunogen: CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC78 Blocking Peptide, catalog no. 33R-7533, is also available for use as a blocking control in assays to test for specificity of this CCDC78 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC78 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC78

Target: CCDC78 (Coiled-Coil Domain Containing 78 (CCDC78))

Alternative Name: CCDC78 (CCDC78 Products)

Synonyms: MGC86539 antibody, C16orf25 antibody, CNM4 antibody, JFP10 antibody, Gm938 antibody, Gm950 antibody, coiled-coil domain containing 78 S homeolog antibody, coiled-coil domain containing 78 antibody, ccdc78.S antibody, CCDC78 antibody, ccdc78 antibody, Ccdc78 antibody

Background: The function of CCDC78 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development