UBLCP1 antibody (N-Term)

Catalog No. ABIN632320

Product Details anti-UBLCP1 Antibody

Target: UBLCP1 (Ubiquitin-Like Domain Containing CTD Phosphatase 1 (UBLCP1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBLCP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBLCP1 antibody was raised against the N terminal of UBLCP1

Purification: Affinity purified

Immunogen: UBLCP1 antibody was raised using the N terminal of UBLCP1 corresponding to a region with amino acids MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBLCP1 Blocking Peptide, catalog no. 33R-5694, is also available for use as a blocking control in assays to test for specificity of this UBLCP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBLCP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBLCP1

Target: UBLCP1 (Ubiquitin-Like Domain Containing CTD Phosphatase 1 (UBLCP1))

Alternative Name: UBLCP1 (UBLCP1 Products)

Synonyms: UBLCP1 antibody, DKFZp459P2311 antibody, wu:fb33g09 antibody, zgc:86634 antibody, CPUB1 antibody, 4930527B16Rik antibody, 8430435I17Rik antibody, BC002236 antibody, RGD1310386 antibody, ubiquitin like domain containing CTD phosphatase 1 antibody, ubiquitin-like domain containing CTD phosphatase 1 antibody, ubiquitin like domain containing CTD phosphatase 1 S homeolog antibody, ublcp1 antibody, Ublcp1 antibody, UBLCP1 antibody, ublcp1.S antibody

Background: UBLCP1 may specifically dephosphorylate 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit.

Molecular Weight: 37 kDa (MW of target protein)