PPP1R11 antibody

Catalog No. ABIN632318

Product Details anti-PPP1R11 Antibody

Target: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP1R11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP1R11 Blocking Peptide, catalog no. 33R-5629, is also available for use as a blocking control in assays to test for specificity of this PPP1R11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP1R11

Target: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Alternative Name: PPP1R11 (PPP1R11 Products)

Synonyms: HCG-V antibody, HCGV antibody, IPP3 antibody, TCTE5 antibody, TCTEX5 antibody, 1500041B02Rik antibody, AV117883 antibody, Hcgv antibody, Tcte5 antibody, Tctex-5 antibody, Tctex5 antibody, wu:fj64e04 antibody, zgc:110245 antibody, protein phosphatase 1 regulatory inhibitor subunit 11 antibody, protein phosphatase 1, regulatory (inhibitor) subunit 11 antibody, PPP1R11 antibody, Ppp1r11 antibody, ppp1r11 antibody

Background: This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1.

Molecular Weight: 14 kDa (MW of target protein)