ASB7 antibody (Middle Region)
-
- Target See all ASB7 Antibodies
- ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASB7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ASB7 antibody was raised against the middle region of ASB7
- Purification
- Affinity purified
- Immunogen
- ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC
- Top Product
- Discover our top product ASB7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASB7 Blocking Peptide, catalog no. 33R-7760, is also available for use as a blocking control in assays to test for specificity of this ASB7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))
- Alternative Name
- ASB7 (ASB7 Products)
- Synonyms
- AI449039 antibody, Asb-7 antibody, D030055C23Rik antibody, asb7 antibody, zgc:77381 antibody, ASB-7 antibody, ankyrin repeat and SOCS box containing 7 antibody, ankyrin repeat and SOCS box-containing 7 antibody, ankyrin repeat and SOCS box containing 7 L homeolog antibody, ASB7 antibody, Asb7 antibody, asb7.L antibody, asb7 antibody
- Background
- The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.
- Molecular Weight
- 36 kDa (MW of target protein)
-