KLHDC2 antibody (N-Term)

Catalog No. ABIN632311

Product Details anti-KLHDC2 Antibody

Target: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHDC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLHDC2 antibody was raised against the N terminal of KLHDC2

Purification: Affinity purified

Immunogen: KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHDC2 Blocking Peptide, catalog no. 33R-9800, is also available for use as a blocking control in assays to test for specificity of this KLHDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHDC2

Target: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Alternative Name: KLHDC2 (KLHDC2 Products)

Synonyms: MGC82652 antibody, HCLP-1 antibody, HCLP1 antibody, LCP antibody, 2310022K15Rik antibody, D12Ertd522e antibody, kelch domain containing 2 L homeolog antibody, kelch domain containing 2 antibody, klhdc2.L antibody, KLHDC2 antibody, Klhdc2 antibody

Background: KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-DNA binding. It contains 6 Kelch repeats.

Molecular Weight: 46 kDa (MW of target protein)