Cyclin J antibody (N-Term)

Catalog No. ABIN632310

Product Details anti-Cyclin J Antibody

Target: Cyclin J (CCNJ)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cyclin J antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cyclin J antibody was raised against the N terminal of CCNJ

Purification: Affinity purified

Immunogen: Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin J Blocking Peptide, catalog no. 33R-2996, is also available for use as a blocking control in assays to test for specificity of this Cyclin J antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cyclin J

Target: Cyclin J (CCNJ)

Alternative Name: Cyclin J (CCNJ Products)

Synonyms: bA690P14.1 antibody, CDI5 antibody, CG10308 antibody, Cdi5 antibody, Dmel\\CG10308 antibody, cdi5 antibody, cycJ antibody, cyclinJ antibody, D430039C20Rik antibody, MGC81420 antibody, ba690p14.1 antibody, cyclin J antibody, Cyclin J antibody, cyclin J S homeolog antibody, CCNJ antibody, CycJ antibody, Ccnj antibody, ccnj.S antibody, ccnj antibody, CpipJ_CPIJ015384 antibody, CpipJ_CPIJ016049 antibody

Background: Cyclin J may be involved in cell division and differentiation.

Molecular Weight: 42 kDa (MW of target protein)