LDHB antibody (C-Term)

Catalog No. ABIN632307

Product Details anti-LDHB Antibody

Target: LDHB (Lactate Dehydrogenase B (LDHB))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LDHB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LDHB antibody was raised against the C terminal of LDHB

Purification: Affinity purified

Immunogen: LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDHB Blocking Peptide, catalog no. 33R-6625, is also available for use as a blocking control in assays to test for specificity of this LDHB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LDHB

Target: LDHB (Lactate Dehydrogenase B (LDHB))

Alternative Name: LDHB (LDHB Products)

Synonyms: LDH-B antibody, LDH-H antibody, LDHBD antibody, TRG-5 antibody, AI790582 antibody, H-Ldh antibody, Ldh-2 antibody, Ldh2 antibody, ldh-h antibody, ldh2 antibody, ldhb antibody, ldhba antibody, trg-5 antibody, LDHB antibody, LDH-B-A antibody, wu:fa16d07 antibody, wu:fa20c10 antibody, wu:fa96a08 antibody, LDH-B-B antibody, zgc:92882 antibody, lactate dehydrogenase B antibody, lactate dehydrogenase B S homeolog antibody, lactate dehydrogenase Ba antibody, lactate dehydrogenase Bb antibody, LDHB antibody, Ldhb antibody, ldhb.S antibody, ldhb antibody, ldhba antibody, ldhbb antibody

Background: LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Warburg Effect