Syntrophin gamma 1 antibody (Middle Region)

Catalog No. ABIN632306

Product Details anti-Syntrophin gamma 1 Antibody

Target: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Syntrophin gamma 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Syntrophin Gamma 1 antibody was raised against the middle region of SNTG1

Purification: Affinity purified

Immunogen: Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Syntrophin Gamma 1 Blocking Peptide, catalog no. 33R-7908, is also available for use as a blocking control in assays to test for specificity of this Syntrophin Gamma 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNTG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Syntrophin gamma 1

Target: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Alternative Name: Syntrophin gamma 1 (SNTG1 Products)

Synonyms: SNTG1 antibody, G1SYN antibody, SYN4 antibody, 4933426D16Rik antibody, RGD1560290 antibody, syntrophin gamma 1 antibody, gamma-1-syntrophin antibody, syntrophin, gamma 1 antibody, SNTG1 antibody, sntg1 antibody, LOC100548083 antibody, Sntg1 antibody

Background: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins.

Molecular Weight: 58 kDa (MW of target protein)