SUN3 antibody (C-Term)

Catalog No. ABIN632305

Product Details anti-SUN3 Antibody

Target: SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SUNC1 antibody was raised against the C terminal of SUNC1

Purification: Affinity purified

Immunogen: SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SUNC1 Blocking Peptide, catalog no. 33R-4024, is also available for use as a blocking control in assays to test for specificity of this SUNC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUNC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUN3

Target: SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))

Alternative Name: SUNC1 (SUN3 Products)

Synonyms: SUNC1 antibody, D630047F21Rik antibody, Sunc1 antibody, Sad1 and UNC84 domain containing 3 antibody, SUN3 antibody, Sun3 antibody

Background: SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.

Molecular Weight: 40 kDa (MW of target protein)