Esterase D antibody (N-Term)

Catalog No. ABIN632304

Product Details anti-Esterase D Antibody

Target: Esterase D (ESD)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Esterase D antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ESD antibody was raised against the N terminal of ESD

Purification: Affinity purified

Immunogen: ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ESD Blocking Peptide, catalog no. 33R-5690, is also available for use as a blocking control in assays to test for specificity of this ESD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Esterase D

Target: Esterase D (ESD)

Alternative Name: ESD (ESD Products)

Synonyms: FGH antibody, Es-10 antibody, Es10 antibody, sid478 antibody, wu:fb58f05 antibody, zgc:111984 antibody, ARABIDOPSIS THALIANA S-FORMYLGLUTATHIONE HYDROLASE antibody, ATSFGH antibody, S-formylglutathione hydrolase antibody, T32G6.5 antibody, T32G6_5 antibody, esterase D antibody, esterase D/formylglutathione hydrolase antibody, S-formylglutathione hydrolase antibody, esterase D L homeolog antibody, ESD antibody, Esd antibody, esd antibody, SFGH antibody, esd.L antibody, NMA1519 antibody, LOC100282053 antibody

Background: ESD is a serine hydrolase involved in the detoxification of formaldehyde.

Molecular Weight: 31 kDa (MW of target protein)