C11orf53 antibody (Middle Region)

Catalog No. ABIN632297

Product Details anti-C11orf53 Antibody

Target: C11orf53 (Chromosome 11 Open Reading Frame 53 (C11orf53))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C11orf53 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C11 ORF53 antibody was raised against the middle region of C11 rf53

Purification: Affinity purified

Immunogen: C11 ORF53 antibody was raised using the middle region of C11 rf53 corresponding to a region with amino acids SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF53 Blocking Peptide, catalog no. 33R-8522, is also available for use as a blocking control in assays to test for specificity of this C11ORF53 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C11orf53

Target: C11orf53 (Chromosome 11 Open Reading Frame 53 (C11orf53))

Alternative Name: C11ORF53 (C11orf53 Products)

Synonyms: chromosome 11 open reading frame 53 antibody, C11orf53 antibody

Background: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 25 kDa (MW of target protein)