CRYM antibody (N-Term)
-
- Target See all CRYM Antibodies
- CRYM (Crystallin, mu (CRYM))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRYM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Crystallin Mu antibody was raised against the N terminal of CRYM
- Purification
- Affinity purified
- Immunogen
- Crystallin Mu antibody was raised using the N terminal of CRYM corresponding to a region with amino acids ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT
- Top Product
- Discover our top product CRYM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Crystallin Mu Blocking Peptide, catalog no. 33R-1375, is also available for use as a blocking control in assays to test for specificity of this Crystallin Mu antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRYM (Crystallin, mu (CRYM))
- Alternative Name
- Crystallin mu (CRYM Products)
- Background
- Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Hormone Transport, Sensory Perception of Sound
-