TRABD antibody (Middle Region)

Catalog No. ABIN632292

Product Details anti-TRABD Antibody

Target: TRABD (TraB Domain Containing (TRABD))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRABD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRABD antibody was raised against the middle region of TRABD

Purification: Affinity purified

Immunogen: TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRABD Blocking Peptide, catalog no. 33R-4818, is also available for use as a blocking control in assays to test for specificity of this TRABD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRABD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRABD

Target: TRABD (TraB Domain Containing (TRABD))

Alternative Name: TRABD (TRABD Products)

Synonyms: TRABD antibody, LP6054 antibody, PP2447 antibody, fb66c10 antibody, wu:fb66c10 antibody, wu:fi04e11 antibody, zgc:66436 antibody, 5730502D15Rik antibody, AL023039 antibody, RGD1310875 antibody, TraB domain containing antibody, TraB domain containing L homeolog antibody, TRABD antibody, trabd antibody, trabd.L antibody, Trabd antibody

Background: The function of TRABD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)