GORASP1 antibody (N-Term)
-
- Target See all GORASP1 Antibodies
- GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GORASP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GORASP1 antibody was raised against the N terminal of GORASP1
- Purification
- Affinity purified
- Immunogen
- GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV
- Top Product
- Discover our top product GORASP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GORASP1 Blocking Peptide, catalog no. 33R-7444, is also available for use as a blocking control in assays to test for specificity of this GORASP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GORASP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))
- Alternative Name
- GORASP1 (GORASP1 Products)
- Background
- The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-