SEC14L4 antibody

Catalog No. ABIN632289

Product Details anti-SEC14L4 Antibody

Target: SEC14L4 (SEC14-Like 4 (SEC14L4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEC14L4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SEC14 L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEC14L4 Blocking Peptide, catalog no. 33R-6510, is also available for use as a blocking control in assays to test for specificity of this SEC14L4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC10 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEC14L4

Target: SEC14L4 (SEC14-Like 4 (SEC14L4))

Alternative Name: SEC14L4 (SEC14L4 Products)

Synonyms: TAP3 antibody, AI256582 antibody, AW536553 antibody, SPF antibody, TAP antibody, RGD1565810 antibody, SEC14 like lipid binding 4 antibody, SEC14-like protein 4 antibody, SEC14-like lipid binding 4 antibody, SEC14L4 antibody, LOC486353 antibody, Sec14l4 antibody

Background: SEC14L4 is a probable hydrophobic ligand-binding protein, may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

Molecular Weight: 47 kDa (MW of target protein)