GRIPAP1 antibody (N-Term)
-
- Target See all GRIPAP1 Antibodies
- GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRIPAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GRIPAP1 antibody was raised against the N terminal of GRIPAP1
- Purification
- Affinity purified
- Immunogen
- GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV
- Top Product
- Discover our top product GRIPAP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GRIPAP1 Blocking Peptide, catalog no. 33R-2618, is also available for use as a blocking control in assays to test for specificity of this GRIPAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIPAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))
- Alternative Name
- GRIPAP1 (GRIPAP1 Products)
- Synonyms
- gripap1 antibody, MGC184827 antibody, zgc:158787 antibody, GRASP-1 antibody, AI854681 antibody, DXImx47e antibody, Sfc10 antibody, mKIAA1167 antibody, Grasp1 antibody, GRIP1 associated protein 1 antibody, gripap1 antibody, GRIPAP1 antibody, Gripap1 antibody
- Background
- This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms, however, the full-length nature and biological validity of all of these variants have not been determined.
- Molecular Weight
- 96 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-