PPME1 antibody (N-Term)

Catalog No. ABIN632281

Product Details anti-PPME1 Antibody

Target: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPME1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PPME1 antibody was raised against the N terminal of PPME1

Purification: Affinity purified

Immunogen: PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPME1 Blocking Peptide, catalog no. 33R-6394, is also available for use as a blocking control in assays to test for specificity of this PPME1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPME1

Target: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Alternative Name: PPME1 (PPME1 Products)

Synonyms: PME-1 antibody, 1110069N17Rik antibody, 2700017M01Rik antibody, Pme1 antibody, fk72d03 antibody, zgc:56239 antibody, wu:fk72d03 antibody, RGD1309683 antibody, PME1MGC133824 antibody, F28M11.4 antibody, DDBDRAFT_0204584 antibody, DDBDRAFT_0305014 antibody, DDB_0204584 antibody, DDB_0305014 antibody, PME1 antibody, CaO19.1459 antibody, protein phosphatase methylesterase 1 antibody, protein phosphatase methylesterase 1 S homeolog antibody, esterase/lipase/thioesterase family protein antibody, carboxylesterase-mitochondrial 37S ribosomal protein YmS2 antibody, PPME1 antibody, Ppme1 antibody, ppme1 antibody, ppme1.S antibody, AT4G10050 antibody, PPE1 antibody

Background: Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process