Allantoicase antibody (N-Term)
-
- Target See all Allantoicase (ALLC) Antibodies
- Allantoicase (ALLC)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Allantoicase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALLC antibody was raised against the N terminal of ALLC
- Purification
- Affinity purified
- Immunogen
- ALLC antibody was raised using the N terminal of ALLC corresponding to a region with amino acids VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
- Top Product
- Discover our top product ALLC Primary Antibody
-
anti-Allantoicase (ALLC) (AA 1-409) antibody
ALLC Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Allantoicase (ALLC) (AA 235-344) antibodyALLC Reactivity: Human WB, ELISA, IP Host: Mouse Monoclonal 3D3 unconjugated
anti-Allantoicase (ALLC) (AA 71-120) antibodyALLC Reactivity: Human, Dog, Horse WB Host: Rabbit Polyclonal unconjugated
anti-Allantoicase (ALLC) (AA 1-409) antibodyALLC Reactivity: Human WB Host: Mouse Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALLC Blocking Peptide, catalog no. 33R-9608, is also available for use as a blocking control in assays to test for specificity of this ALLC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALLC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Allantoicase (ALLC)
- Alternative Name
- ALLC (ALLC Products)
- Synonyms
- PSPTO3668 antibody, ALC antibody, 1700012B22Rik antibody, Alc antibody, zgc:91799 antibody, allantoicase antibody, allantoicase L homeolog antibody, allc antibody, ALLC antibody, PSPTO_3668 antibody, BPSL2945 antibody, BPSL2116 antibody, CND02340 antibody, allC antibody, Gbro_4026 antibody, BC1002_2649 antibody, Tbis_2589 antibody, Arnit_1068 antibody, Srot_2184 antibody, Ndas_0715 antibody, Psed_1757 antibody, Sinme_4918 antibody, Allc antibody, allc.L antibody
- Background
- Allantoicase participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase, was lost during vertebrate evolution.
- Molecular Weight
- 43 kDa (MW of target protein)
-
