CAB39 antibody (Middle Region)

Catalog No. ABIN632269

Product Details anti-CAB39 Antibody

Target: CAB39 (Calcium Binding Protein 39 (CAB39))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAB39 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CAB39 antibody was raised against the middle region of CAB39

Purification: Affinity purified

Immunogen: CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAB39 Blocking Peptide, catalog no. 33R-4688, is also available for use as a blocking control in assays to test for specificity of this CAB39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAB39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAB39

Target: CAB39 (Calcium Binding Protein 39 (CAB39))

Alternative Name: CAB39 (CAB39 Products)

Synonyms: CG4083 antibody, Dmel\\CG4083 antibody, Dmo25 antibody, dMo25 antibody, l(3)00274 antibody, mo25 antibody, fc06a03 antibody, zgc:86716 antibody, wu:fc06a03 antibody, MGC78903 antibody, CAB39 antibody, MO25 antibody, AA408805 antibody, AA960512 antibody, C78372 antibody, MO25alpha antibody, CG4083 gene product from transcript CG4083-RA antibody, calcium binding protein 39 antibody, calcium binding protein 39 L homeolog antibody, Cab39 protein antibody, Mo25 antibody, cab39 antibody, cab39.L antibody, CAB39 antibody, Bm1_33380 antibody, Cab39 antibody

Background: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: AMPK Signaling