PRKY antibody (N-Term)
-
- Target See all PRKY products
- PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKY antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKY antibody was raised against the N terminal of PRKY
- Purification
- Affinity purified
- Immunogen
- PRKY antibody was raised using the N terminal of PRKY corresponding to a region with amino acids MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKY Blocking Peptide, catalog no. 33R-5895, is also available for use as a blocking control in assays to test for specificity of this PRKY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))
- Alternative Name
- PRKY (PRKY Products)
- Synonyms
- PRKXP3 antibody, PRKYP antibody, protein kinase, Y-linked, pseudogene antibody, PRKY antibody
- Background
- This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome.
- Molecular Weight
- 32 kDa (MW of target protein)
-