C1ORF110 antibody (N-Term)
-
- Target See all C1ORF110 Antibodies
- C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1ORF110 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 ORF110 antibody was raised against the N terminal Of C1 rf110
- Purification
- Affinity purified
- Immunogen
- C1 ORF110 antibody was raised using the N terminal Of C1 rf110 corresponding to a region with amino acids LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED
- Top Product
- Discover our top product C1ORF110 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1ORF110 Blocking Peptide, catalog no. 33R-5112, is also available for use as a blocking control in assays to test for specificity of this C1ORF110 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF110 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))
- Alternative Name
- C1ORF110 (C1ORF110 Products)
- Synonyms
- C1orf110 antibody, coiled-coil domain containing 190 antibody, CCDC190 antibody, Ccdc190 antibody
- Background
- The function of C1orf110 has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 34 kDa (MW of target protein)
-