WDR66 antibody (N-Term)

Catalog No. ABIN632250

Product Details anti-WDR66 Antibody

Target: WDR66 (WD Repeat Domain 66 (WDR66))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR66 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR66 antibody was raised against the N terminal of WDR66

Purification: Affinity purified

Immunogen: WDR66 antibody was raised using the N terminal of WDR66 corresponding to a region with amino acids GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR66 Blocking Peptide, catalog no. 33R-3234, is also available for use as a blocking control in assays to test for specificity of this WDR66 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR66 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR66

Target: WDR66 (WD Repeat Domain 66 (WDR66))

Alternative Name: WDR66 (WDR66 Products)

Synonyms: 4930415N18Rik antibody, 4933428F06Rik antibody, 5031404N07 antibody, RGD1564948 antibody, DKFZp469N2128 antibody, WD repeat domain 66 antibody, WDR66 antibody, Wdr66 antibody, wdr66 antibody

Background: WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.

Molecular Weight: 130 kDa (MW of target protein)