TRIB1 antibody

Catalog No. ABIN632249

Product Details anti-TRIB1 Antibody

Target: TRIB1 (Tribbles Homolog 1 (TRIB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIB1 Blocking Peptide, catalog no. 33R-9035, is also available for use as a blocking control in assays to test for specificity of this TRIB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIB1

Target: TRIB1 (Tribbles Homolog 1 (TRIB1))

Alternative Name: TRIB1 (TRIB1 Products)

Synonyms: TRIB1 antibody, c8fw antibody, gig2 antibody, skip1 antibody, trb1 antibody, tribbles antibody, C8FW antibody, GIG2 antibody, SKIP1 antibody, TRB1 antibody, A530090O15Rik antibody, TRB-1 antibody, Trb1 antibody, Gig2 antibody, tribbles pseudokinase 1 antibody, tribbles pseudokinase 1 L homeolog antibody, tribbles homolog 1 (Drosophila) antibody, TRIB1 antibody, trib1 antibody, trib1.L antibody, Trib1 antibody

Background: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration