TBCB antibody (C-Term)

Catalog No. ABIN632246

Product Details anti-TBCB Antibody

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBCB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBCB antibody was raised against the C terminal of TBCB

Purification: Affinity purified

Immunogen: TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBCB Blocking Peptide, catalog no. 33R-10065, is also available for use as a blocking control in assays to test for specificity of this TBCB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBCB

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Alternative Name: TBCB (TBCB Products)

Background: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Molecular Weight: 27 kDa (MW of target protein)