KLHDC8B antibody (N-Term)

Catalog No. ABIN632243

Product Details anti-KLHDC8B Antibody

Target: KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHDC8B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLHDC8 B antibody was raised against the N terminal of KLHDC8

Purification: Affinity purified

Immunogen: KLHDC8 B antibody was raised using the N terminal of KLHDC8 corresponding to a region with amino acids MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHDC8B Blocking Peptide, catalog no. 33R-6393, is also available for use as a blocking control in assays to test for specificity of this KLHDC8B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHDC8B

Target: KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))

Alternative Name: KLHDC8B (KLHDC8B Products)

Synonyms: DKFZp468J2023 antibody, 4931406O17Rik antibody, kelch domain containing 8B antibody, KLHDC8B antibody, Klhdc8b antibody

Background: KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown.

Molecular Weight: 38 kDa (MW of target protein)