MAP4K1 antibody (N-Term)

Catalog No. ABIN632239

Product Details anti-MAP4K1 Antibody

Target: MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP4K1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP4 K1 antibody was raised against the N terminal of MAP4 1

Purification: Affinity purified

Immunogen: MAP4 K1 antibody was raised using the N terminal of MAP4 1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP4K1 Blocking Peptide, catalog no. 33R-9582, is also available for use as a blocking control in assays to test for specificity of this MAP4K1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP4K1

Target: MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))

Alternative Name: MAP4K1 (MAP4K1 Products)

Synonyms: HPK1 antibody, Hpk1 antibody, mHPK1 antibody, mitogen activated protein kinase kinase kinase kinase 1 antibody, mitogen-activated protein kinase kinase kinase kinase 1 antibody, Map4k1 antibody, MAP4K1 antibody

Background: MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: TCR Signaling, Signaling of Hepatocyte Growth Factor Receptor