FAM53C antibody (N-Term)

Catalog No. ABIN632235

Product Details anti-FAM53C Antibody

Target: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM53C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM53 C antibody was raised against the N terminal of FAM53

Purification: Affinity purified

Immunogen: FAM53 C antibody was raised using the N terminal of FAM53 corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM53C Blocking Peptide, catalog no. 33R-8648, is also available for use as a blocking control in assays to test for specificity of this FAM53C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM53C

Target: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Alternative Name: FAM53C (FAM53C Products)

Synonyms: C5orf6 antibody, 2810012G03Rik antibody, family with sequence similarity 53 member C antibody, family with sequence similarity 53, member C antibody, FAM53C antibody, Fam53c antibody

Background: The function of FAM53 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 43 kDa (MW of target protein)