SH3BP4 antibody (N-Term)

Catalog No. ABIN632230

Product Details anti-SH3BP4 Antibody

Target: SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3BP4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SH3 BP4 antibody was raised against the N terminal of SH3 P4

Purification: Affinity purified

Immunogen: SH3 BP4 antibody was raised using the N terminal of SH3 P4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3BP4 Blocking Peptide, catalog no. 33R-3104, is also available for use as a blocking control in assays to test for specificity of this SH3BP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3BP4

Target: SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))

Alternative Name: SH3BP4 (SH3BP4 Products)

Synonyms: BOG25 antibody, TTP antibody, AI594717 antibody, AW227605 antibody, SH3BP4 antibody, bog25 antibody, ttp antibody, LOC569399 antibody, sh3bp4 antibody, SH3 domain binding protein 4 antibody, SH3-domain binding protein 4 antibody, SH3-domain binding protein 4 L homeolog antibody, SH3BP4 antibody, Sh3bp4 antibody, sh3bp4 antibody, sh3bp4.L antibody

Background: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Molecular Weight: 107 kDa (MW of target protein)