SH3BP4 antibody (N-Term)
-
- Target See all SH3BP4 Antibodies
- SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SH3BP4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SH3 BP4 antibody was raised against the N terminal of SH3 P4
- Purification
- Affinity purified
- Immunogen
- SH3 BP4 antibody was raised using the N terminal of SH3 P4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
- Top Product
- Discover our top product SH3BP4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SH3BP4 Blocking Peptide, catalog no. 33R-3104, is also available for use as a blocking control in assays to test for specificity of this SH3BP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))
- Alternative Name
- SH3BP4 (SH3BP4 Products)
- Synonyms
- BOG25 antibody, TTP antibody, AI594717 antibody, AW227605 antibody, SH3BP4 antibody, bog25 antibody, ttp antibody, LOC569399 antibody, sh3bp4 antibody, SH3 domain binding protein 4 antibody, SH3-domain binding protein 4 antibody, SH3-domain binding protein 4 L homeolog antibody, SH3BP4 antibody, Sh3bp4 antibody, sh3bp4 antibody, sh3bp4.L antibody
- Background
- This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.
- Molecular Weight
- 107 kDa (MW of target protein)
-