Glutaredoxin 1 antibody
-
- Target See all Glutaredoxin 1 (GRX1) Antibodies
- Glutaredoxin 1 (GRX1)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glutaredoxin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV
- Top Product
- Discover our top product GRX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLRX Blocking Peptide, catalog no. 33R-4029, is also available for use as a blocking control in assays to test for specificity of this GLRX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glutaredoxin 1 (GRX1)
- Alternative Name
- GLRX (GRX1 Products)
- Synonyms
- Glrx1 antibody, Grx antibody, grx antibody, wu:fc38f02 antibody, zgc:103707 antibody, GLRXL antibody, Grx1 antibody, TTase antibody, C86710 antibody, D13Wsu156e antibody, grx1 antibody, GLRX antibody, GRX antibody, GRX1 antibody, GLRX1 antibody, TTF antibody, glrx antibody, glutaredoxin antibody, glutaredoxin (thioltransferase) antibody, glutaredoxin Grx1 antibody, NrdH-redoxin antibody, Uncharacterized monothiol glutaredoxin F10D7.3 antibody, glutaredoxin-1 (Grx1) antibody, temporal expression: late antibody, glutaredoxin L homeolog antibody, Glrx antibody, glrx antibody, GLRX antibody, grx1 antibody, AF_RS07750 antibody, F10D7.3 antibody, AFUA_1G06100 antibody, NT01EI_2528 antibody, O2L antibody, glrx.L antibody
- Target Type
- Viral Protein
- Background
- GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.
- Molecular Weight
- 12 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-