ADPRM antibody (N-Term)

Catalog No. ABIN632213

Product Details anti-ADPRM Antibody

Target: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADPRM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C17 ORF48 antibody was raised against the N terminal Of C17 rf48

Purification: Affinity purified

Immunogen: C17 ORF48 antibody was raised using the N terminal Of C17 rf48 corresponding to a region with amino acids MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF48 Blocking Peptide, catalog no. 33R-5825, is also available for use as a blocking control in assays to test for specificity of this C17ORF48 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADPRM

Target: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Alternative Name: C17ORF48 (C17orf48 Products)

Synonyms: 2310004I24Rik antibody, MDS006 antibody, C17orf48 antibody, NBLA03831 antibody, C19H17orf48 antibody, ADPRibase-Mn antibody, RGD1309906 antibody, c17orf48 antibody, mds006 antibody, ADP-ribose/CDP-alcohol diphosphatase, manganese dependent antibody, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent antibody, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent L homeolog antibody, Adprm antibody, ADPRM antibody, adprm.L antibody

Background: C17ORF48 hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.

Molecular Weight: 39 kDa (MW of target protein)