CAMKV antibody (N-Term)

Catalog No. ABIN632211

Product Details anti-CAMKV Antibody

Target: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAMKV antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CAMKV antibody was raised against the N terminal of CAMKV

Purification: Affinity purified

Immunogen: CAMKV antibody was raised using the N terminal of CAMKV corresponding to a region with amino acids NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAMKV Blocking Peptide, catalog no. 33R-6867, is also available for use as a blocking control in assays to test for specificity of this CAMKV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAMKV

Target: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Alternative Name: CAMKV (CAMKV Products)

Synonyms: camkv antibody, zgc:63506 antibody, CAMKV antibody, 1G5 antibody, VACAMKL antibody, BB074618 antibody, BC017634 antibody, CaM kinase-like vesicle-associated b antibody, CaM kinase like vesicle associated antibody, CaM kinase-like vesicle-associated antibody, camkvb antibody, CAMKV antibody, camkv antibody, Camkv antibody

Background: CAMKV does not appear to have detectable kinase activity.

Molecular Weight: 55 kDa (MW of target protein)