GNGT2 antibody (Middle Region)
-
- Target See all GNGT2 Antibodies
- GNGT2 (Guanine Nucleotide Binding Protein (G Protein), gamma Transducing Activity Polypeptide 2 (GNGT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNGT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GNGT2 antibody was raised against the middle region of Gngt2
- Purification
- Affinity purified
- Immunogen
- GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
- Top Product
- Discover our top product GNGT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GNGT2 Blocking Peptide, catalog no. 33R-4362, is also available for use as a blocking control in assays to test for specificity of this GNGT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNGT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNGT2 (Guanine Nucleotide Binding Protein (G Protein), gamma Transducing Activity Polypeptide 2 (GNGT2))
- Alternative Name
- GNGT2 (GNGT2 Products)
- Synonyms
- G-GAMMA-8 antibody, G-GAMMA-C antibody, GNG8 antibody, GNG9 antibody, GNGT8 antibody, AV096488 antibody, gngt2 antibody, id:ibd1139 antibody, wu:fk53d05 antibody, G protein subunit gamma transducin 2 antibody, guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 antibody, guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2a antibody, GNGT2 antibody, Gngt2 antibody, gngt2a antibody
- Background
- Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.
- Molecular Weight
- 8 kDa (MW of target protein)
-