C12ORF24 antibody (N-Term)

Catalog No. ABIN632209

Product Details anti-C12ORF24 Antibody

Target: C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C12ORF24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C12 ORF24 antibody was raised against the N terminal Of C12 rf24

Purification: Affinity purified

Immunogen: C12 ORF24 antibody was raised using the N terminal Of C12 rf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C12ORF24 Blocking Peptide, catalog no. 33R-1583, is also available for use as a blocking control in assays to test for specificity of this C12ORF24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C12ORF24

Target: C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))

Alternative Name: C12ORF24 (C12orf24 Products)

Synonyms: C12orf24 antibody, C17H12orf24 antibody, HSU79274 antibody, 1500011H22Rik antibody, family with sequence similarity 216 member A antibody, family with sequence similarity 216, member A antibody, FAM216A antibody, Fam216a antibody

Background: The function of C12orf24 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 31 kDa (MW of target protein)