C11orf65 antibody (N-Term)

Catalog No. ABIN632207

Product Details anti-C11orf65 Antibody

Target: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C11orf65 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C11 ORF65 antibody was raised against the N terminal Of C11 rf65

Purification: Affinity purified

Immunogen: C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF65 Blocking Peptide, catalog no. 33R-6312, is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C11orf65

Target: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Alternative Name: C11ORF65 (C11orf65 Products)

Synonyms: AU017961 antibody, chromosome 11 open reading frame 65 antibody, chromosome 11 open reading frame 65 L homeolog antibody, chromosome 14 open reading frame, human C11orf65 antibody, RIKEN cDNA 4930550C14 gene antibody, similar to RIKEN cDNA 4930550C14 antibody, C11orf65 antibody, c11orf65.L antibody, C14H11orf65 antibody, 4930550C14Rik antibody, RGD1311251 antibody

Background: The specific function of C11orf65 is not yet known.

Molecular Weight: 37 kDa (MW of target protein)