VIPAR antibody (Middle Region)
-
- Target See all VIPAR Antibodies
- VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VIPAR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VIPAR antibody was raised against the middle region of VIPAR
- Purification
- Affinity purified
- Immunogen
- VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI
- Top Product
- Discover our top product VIPAR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VIPAR Blocking Peptide, catalog no. 33R-9490, is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))
- Alternative Name
- VIPAR (VIPAR Products)
- Synonyms
- C8H14orf133 antibody, VIPAR antibody, VPS16 antibody, VPS16A antibody, spe39 antibody, spe-39 antibody, vps16b antibody, MGC85203 antibody, c14orf133 antibody, C14orf133 antibody, SPE-39 antibody, SPE39 antibody, VPS16B antibody, hSPE-39 antibody, 6720456H09Rik antibody, 9330175H22Rik antibody, AI413782 antibody, Spe39 antibody, Vipar antibody, si:ch211-20b12.1 antibody, vipar antibody, wu:fb63f10 antibody, C10H14orf133 antibody, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog antibody, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog L homeolog antibody, VIPAS39 antibody, vipas39.L antibody, vipas39 antibody, Vipas39 antibody
- Background
- This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.
- Molecular Weight
- 57 kDa (MW of target protein)
-