GTR2 antibody (N-Term)

Catalog No. ABIN632203

Product Details anti-GTR2 Antibody

Target: GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GTR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RRAGC antibody was raised against the N terminal of RRAGC

Purification: Affinity purified

Immunogen: RRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRAGC Blocking Peptide, catalog no. 33R-8180, is also available for use as a blocking control in assays to test for specificity of this RRAGC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GTR2

Target: GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))

Alternative Name: RRAGC (RRAGC Products)

Synonyms: GTR2 antibody, RAGC antibody, TIB929 antibody, AU041672 antibody, Gtr2 antibody, YGR163W antibody, RRAGC antibody, gtr2 antibody, ragc antibody, rragc antibody, zgc:111971 antibody, Ras related GTP binding C antibody, Ras-related GTP binding C antibody, Ras related GTP binding C S homeolog antibody, Ras-related GTP binding Ca antibody, RRAGC antibody, Rragc antibody, rragc.S antibody, rragc antibody, rragca antibody

Background: RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Autophagy