RRAGD antibody (Middle Region)
-
- Target See all RRAGD Antibodies
- RRAGD (Ras-Related GTP Binding D (RRAGD))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RRAGD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RRAGD antibody was raised against the middle region of RRAGD
- Purification
- Affinity purified
- Immunogen
- RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL
- Top Product
- Discover our top product RRAGD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RRAGD Blocking Peptide, catalog no. 33R-1669, is also available for use as a blocking control in assays to test for specificity of this RRAGD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RRAGD (Ras-Related GTP Binding D (RRAGD))
- Alternative Name
- RRAGD (RRAGD Products)
- Synonyms
- RAGD antibody, bA11D8.2.1 antibody, 5730543C08Rik antibody, AI467523 antibody, C030003H22Rik antibody, D4Ertd174e antibody, Ras related GTP binding D antibody, Ras-related GTP binding D antibody, RRAGD antibody, Rragd antibody
- Background
- RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.
- Molecular Weight
- 45 kDa (MW of target protein)
-