serine Dehydratase antibody (N-Term)

Catalog No. ABIN632200

Product Details anti-serine Dehydratase Antibody

Target: serine Dehydratase (SDS)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This serine Dehydratase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SDS antibody was raised against the N terminal of SDS

Purification: Affinity purified

Immunogen: SDS antibody was raised using the N terminal of SDS corresponding to a region with amino acids AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDS Blocking Peptide, catalog no. 33R-1011, is also available for use as a blocking control in assays to test for specificity of this SDS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for serine Dehydratase

Target: serine Dehydratase (SDS)

Alternative Name: SDS (SDS Products)

Synonyms: SDH antibody, RATSDHE1 antibody, SDH2 antibody, Sdh antibody, Sdhe1 antibody, TDH antibody, 4432411H13Rik antibody, sdh antibody, serine dehydratase antibody, serine dehydratase S homeolog antibody, SDS antibody, Sds antibody, sds.S antibody, sds antibody

Background: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly